PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03149.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CPP
Protein Properties Length: 653aa    MW: 71467.1 Da    PI: 9.6053
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03149.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR413.8e-13208245240
                             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                     +kk CnC++s+Clk+YCeCfa+g++C+  C+C +C+N+ 
  Zmw_sc03149.1.g00140.1.am.mkhc 208 KKKCCNCRNSRCLKLYCECFASGAYCDG-CNCINCFNNP 245
                                     799*************************.********96 PP

2TCR50.73.5e-16291330140
                             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Zmw_sc03149.1.g00140.1.am.mkhc 291 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 330
                                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.0E-15207247IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.93208331IPR005172CRC domain
PfamPF036381.8E-9209244IPR005172CRC domain
SMARTSM011148.4E-20291332IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12294329IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 653 aa     Download sequence    Send to blast
GQNPSFPSAA NARRRSRRHL RSGVRPRTIC RRLPRSRGGS PRPPRIRSFG VEWMAGKEPA  60
GGGPHQRPPT PAVSSQPPVK KLVRQLDFNS AAMAGNPAMA AAAAAVSRAL QPRAAHVGLP  120
HQQHTRATVP LGVPQQMQHR GLPVLRPHQA VGHVPLPRMA VAVPVPQLRP TLVQPVPRPP  180
VSVPLSVKPE SPNPRAKLYE GKDGTPTKKK CCNCRNSRCL KLYCECFASG AYCDGCNCIN  240
CFNNPGNDVT RREAIDATLE RNPDAFRPKI GSSPHTNRNN EASGDPPLVG KHNKGCHCKK  300
SGCLKKYCEC FQANILCSEN CKCMDCKNFE GSEERKAIFQ GDHKSSIHMQ QTANAAVNGA  360
IGVTGFSSPS ASRKRKQIEP SLDLSNKDHV VNKNCHLLQN AMPDGSVPIS QSVHPPTLGP  420
FKVTYRPLLA DIVQPDDIKE LCKLLVVVSG EAAKAYTDRK TQEEKAAKTE DQKPGPGTST  480
NHDREENNQD VDQKSFINDT SSVGTHMGKA LQEEYRPNCP DDQKSNRPMS PGTLALMCDE  540
QDTMFTTSQN AVSQESVPSN SNRSEQYVEQ ERCVLTEFRD CLRKLVTCGR MKEERYSMAI  600
KPEASAHLGQ VNGVSRVPYS KVDVPSVVQT FLQSSSSQPV TGHLDKRLKP DKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1371376SRKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970042.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X2
TrEMBLK3XFR10.0K3XFR1_SETIT; Uncharacterized protein
STRINGSi000730m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47303657